Lineage for d1dzqb_ (1dzq B:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 794080Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 794081Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families) (S)
  5. 794082Family b.29.1.1: Legume lectins [49900] (4 proteins)
  6. 794214Protein Legume lectin [49904] (23 species)
  7. 794333Species Furze (Ulex europaeus), UEA-II [TaxId:3902] [49918] (5 PDB entries)
  8. 794343Domain d1dzqb_: 1dzq B: [24148]

Details for d1dzqb_

PDB Entry: 1dzq (more details), 2.85 Å

PDB Description: lectin uea-ii complexed with galactose
PDB Compounds: (B:) ulex europaeus lectin II (uea-II)

SCOP Domain Sequences for d1dzqb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dzqb_ b.29.1.1 (B:) Legume lectin {Furze (Ulex europaeus), UEA-II [TaxId: 3902]}
sddlsfnfdkfvpnqkniifqgdasvsttgvlqvtkvskptttsigralyaapiqiwdsi
tgkvasfatsfsfvvkadksdgvdglafflapansqipsgssagmfglfsssdskssnqi
iavefdtyfgkaynpwdpdfkhigidvnsiksiktvkwdwrngevadvvityraptkslt
vclsypsdgtsniitasvdlkailpewvsvgfsggvgnaaefethdvlswyftsnle

SCOP Domain Coordinates for d1dzqb_:

Click to download the PDB-style file with coordinates for d1dzqb_.
(The format of our PDB-style files is described here.)

Timeline for d1dzqb_: