Lineage for d1dzqb_ (1dzq B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2778276Family b.29.1.1: Legume lectins [49900] (5 proteins)
  6. 2778483Protein Legume lectin [49904] (23 species)
  7. 2778564Species Furze (Ulex europaeus), UEA-II [TaxId:3902] [49918] (5 PDB entries)
  8. 2778576Domain d1dzqb_: 1dzq B: [24148]
    complexed with ca, gal, mn, nag

Details for d1dzqb_

PDB Entry: 1dzq (more details), 2.85 Å

PDB Description: lectin uea-ii complexed with galactose
PDB Compounds: (B:) lectin II

SCOPe Domain Sequences for d1dzqb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dzqb_ b.29.1.1 (B:) Legume lectin {Furze (Ulex europaeus), UEA-II [TaxId: 3902]}
sddlsfnfdkfvpnqkniifqgdasvsttgvlqvtkvskptttsigralyaapiqiwdsi
tgkvasfatsfsfvvkadksdgvdglafflapansqipsgssagmfglfsssdskssnqi
iavefdtyfgkaynpwdpdfkhigidvnsiksiktvkwdwrngevadvvityraptkslt
vclsypsdgtsniitasvdlkailpewvsvgfsggvgnaaefethdvlswyftsnle

SCOPe Domain Coordinates for d1dzqb_:

Click to download the PDB-style file with coordinates for d1dzqb_.
(The format of our PDB-style files is described here.)

Timeline for d1dzqb_: