SCOPe 2.08: Domain d2crpa1: 2crp A:8-144

Lineage for d2crpa1 (2crp A:8-144)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.91: Regulator of G-protein signaling, RGS [48096] (1 superfamily)
   multihelical; consists of two all-alpha subdomains
   contains a 4-helical bundle with left-handed twist and up-and-down topology

4. Superfamily a.91.1: Regulator of G-protein signaling, RGS [48097] (2 families)

5. Family a.91.1.0: automated matches [191379] (1 protein)
   not a true family

6. Protein automated matches [190464] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187381] (38 PDB entries)

8. Domain d2crpa1: 2crp A:8-144 [241477]
   Other proteins in same PDB: d2crpa2, d2crpa3
   automated match to d2odeb_

Details for d2crpa1

PDB Entry: 2crp

PDB Description: solution structure of the rgs domain of regulator of g-protein signalling 5 (rgs 5)

PDB Compounds: (A:) Regulator of G-protein signaling 5

SCOPe Domain Sequences for d2crpa1:

Sequence; same for both SEQRES and ATOM records:

>d2crpa1 a.91.1.0 (A:8-144) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pekpaktqktsldealqwrdsldkllqnnyglasfksflksefseenlefwiacedykki
kspakmaekakqiyeefiqteapkevnidhftkditmknlvepslssfdmaqkrihalme
kdslprfvrsefyqeli

Timeline for d2crpa1:

• d2crpa1 first appeared in SCOPe 2.04, called d2crpa_
  
• d2crpa1 appears in SCOPe 2.07