SCOPe 2.08: Domain d2crja1: 2crj A:8-86

Lineage for d2crja1 (2crj A:8-86)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.21: HMG-box [47094] (1 superfamily)
   3 helices; irregular array

4. Superfamily a.21.1: HMG-box [47095] (2 families)

5. Family a.21.1.0: automated matches [191668] (1 protein)
   not a true family

6. Protein automated matches [191268] (4 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [254956] (2 PDB entries)

8. Domain d2crja1: 2crj A:8-86 [241476]
   Other proteins in same PDB: d2crja2, d2crja3
   automated match to d1v63a_

Details for d2crja1

PDB Entry: 2crj

PDB Description: solution structure of the hmg domain of mouse hmg domain protein hmgx2

PDB Compounds: (A:) SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1-related

SCOPe Domain Sequences for d2crja1:

Sequence; same for both SEQRES and ATOM records:

>d2crja1 a.21.1.0 (A:8-86) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
pkapvtgyvrflnerreqirtrhpdlpfpeitkmlgaewsklqpaekqryldeaekekqq
ylkelwayqqseaykvcte

Timeline for d2crja1:

• d2crja1 first appeared in SCOPe 2.04, called d2crja_
  
• d2crja1 appears in SCOPe 2.07