Class a: All alpha proteins [46456] (290 folds) |
Fold a.21: HMG-box [47094] (1 superfamily) 3 helices; irregular array |
Superfamily a.21.1: HMG-box [47095] (2 families) |
Family a.21.1.0: automated matches [191668] (1 protein) not a true family |
Protein automated matches [191268] (4 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [254956] (2 PDB entries) |
Domain d2crja1: 2crj A:8-86 [241476] Other proteins in same PDB: d2crja2, d2crja3 automated match to d1v63a_ |
PDB Entry: 2crj (more details)
SCOPe Domain Sequences for d2crja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2crja1 a.21.1.0 (A:8-86) automated matches {Mouse (Mus musculus) [TaxId: 10090]} pkapvtgyvrflnerreqirtrhpdlpfpeitkmlgaewsklqpaekqryldeaekekqq ylkelwayqqseaykvcte
Timeline for d2crja1: