Lineage for d2cr7a_ (2cr7 A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1493378Fold a.59: PAH2 domain [47761] (1 superfamily)
    4 helices; open up-and-down bundle; binds alpha-helical peptides
  4. 1493379Superfamily a.59.1: PAH2 domain [47762] (1 family) (S)
  5. 1493380Family a.59.1.1: PAH2 domain [47763] (3 proteins)
  6. 1493388Protein Sin3B [47764] (1 species)
  7. 1493389Species Mouse (Mus musculus) [TaxId:10090] [47765] (4 PDB entries)
  8. 1493393Domain d2cr7a_: 2cr7 A: [241473]
    automated match to d2f05a1

Details for d2cr7a_

PDB Entry: 2cr7 (more details)

PDB Description: solution structure of the first pah domain of the mouse transcriptional repressor sin3b
PDB Compounds: (A:) paired amphipathic helix protein sin3b

SCOPe Domain Sequences for d2cr7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cr7a_ a.59.1.1 (A:) Sin3B {Mouse (Mus musculus) [TaxId: 10090]}
gssgssgvhvedaltyldqvkirfgsdpatyngfleimkefksqsidtpgvirrvsqlfh
ehpdlivgfnaflpsgpssg

SCOPe Domain Coordinates for d2cr7a_:

Click to download the PDB-style file with coordinates for d2cr7a_.
(The format of our PDB-style files is described here.)

Timeline for d2cr7a_: