Lineage for d2cr0a_ (2cr0 A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1776751Fold b.15: HSP20-like chaperones [49763] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 1776752Superfamily b.15.1: HSP20-like chaperones [49764] (5 families) (S)
  5. 1776839Family b.15.1.4: Nuclear movement domain [117092] (2 proteins)
    Pfam PF03593
  6. 1776840Protein Nuclear migration protein nudC [117093] (1 species)
  7. 1776841Species Mouse (Mus musculus) [TaxId:10090] [117094] (2 PDB entries)
    Uniprot O35685 171-288
  8. 1776842Domain d2cr0a_: 2cr0 A: [241472]
    automated match to d1wgva_

Details for d2cr0a_

PDB Entry: 2cr0 (more details)

PDB Description: Solution structure of nuclear move domain of nuclear distribution gene C
PDB Compounds: (A:) Nuclear migration protein nudC

SCOPe Domain Sequences for d2cr0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cr0a_ b.15.1.4 (A:) Nuclear migration protein nudC {Mouse (Mus musculus) [TaxId: 10090]}
gssgssgkpnlgngadlpnyrwtqtlaeldlavpfrvsfrlkgkdvvvdiqrrhlrvglk
gqppvvdgelynevkveesswliedgkvvtvhlekinkmewwnrlvtsdpeintksgpss
g

SCOPe Domain Coordinates for d2cr0a_:

Click to download the PDB-style file with coordinates for d2cr0a_.
(The format of our PDB-style files is described here.)

Timeline for d2cr0a_: