| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies) 4 helices, bundle; helix 3 is shorter than others; up-and-down |
Superfamily a.28.1: ACP-like [47336] (4 families) ![]() |
| Family a.28.1.0: automated matches [191582] (1 protein) not a true family |
| Protein automated matches [191038] (29 species) not a true protein |
| Species Streptomyces coelicolor [TaxId:100226] [255091] (1 PDB entry) |
| Domain d2cnra_: 2cnr A: [241470] automated match to d1x3oa_ |
PDB Entry: 2cnr (more details)
SCOPe Domain Sequences for d2cnra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cnra_ a.28.1.0 (A:) automated matches {Streptomyces coelicolor [TaxId: 100226]}
maatqeeivaglaeivneiagipvedvkldksftddldvdslsmvevvvaaeerfdvkip
dddvknlktvgdatkyildhqa
Timeline for d2cnra_: