Lineage for d1qosb_ (1qos B:)
- Root: SCOP 1.61
Class b: All beta proteins [48724] (111 folds) 
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (14 families) 
Family b.29.1.1: Legume lectins [49900] (4 proteins) 
Protein Legume lectin [49904] (20 species) 
Species Furze (Ulex europaeus), UEA-II [TaxId:3902] [49918] (5 PDB entries) 
Domain d1qosb_: 1qos B: [24146]
Details for d1qosb_
PDB Entry: 1qos (more details), 2.95 Å
PDB Description: lectin uea-ii complexed with chitobiose
SCOP Domain Sequences for d1qosb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qosb_ b.29.1.1 (B:) Legume lectin {Furze (Ulex europaeus), UEA-II}
sddlsfnfdkfvpnqkniifqgdasvsttgvlqvtkvskptttsigralyaapiqiwdsi
tgkvasfatsfsfvvkadksdgvdglafflapansqipsgssagmfglfsssdskssnqi
iavefdtyfgkaynpwdpdfkhigidvnsiksiktvkwdwrngevadvvityraptkslt
vclsypsdgtsniitasvdlkailpewvsvgfsggvgnaaefethdvlswyftsnle
SCOP Domain Coordinates for d1qosb_:
Click to download the PDB-style file with coordinates for d1qosb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1qosb_:
- d1qosb_ first appeared (with stable ids) in SCOP 1.55
- d1qosb_ appears in SCOP 1.59
- d1qosb_ appears in SCOP 1.63
- d1qosb_ appears in the current release, SCOPe 2.08
View in 3D
