SCOPe 2.04: Domain d2cgqa_: 2cgq A:

Lineage for d2cgqa_ (2cgq A:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
   4 helices, bundle; helix 3 is shorter than others; up-and-down

4. Superfamily a.28.1: ACP-like [47336] (4 families)

5. Family a.28.1.0: automated matches [191582] (1 protein)
   not a true family

6. Protein automated matches [191038] (14 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:83332] [255086] (1 PDB entry)

8. Domain d2cgqa_: 2cgq A: [241452]
   automated match to d2ehta_

Details for d2cgqa_

PDB Entry: 2cgq, 1.83 Å

PDB Description: a putative acyl carrier protein(rv0033) from mycobacterium tuberculosis

PDB Compounds: (A:) acyl carrier protein acpa

SCOPe Domain Sequences for d2cgqa_:

Sequence; same for both SEQRES and ATOM records:

>d2cgqa_ a.28.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
ameeainatiqrilrtdrgitanqvlvddlgfdslklfqliteledefdiaisfrdaqni
ktvgdvytsvavwf

Timeline for d2cgqa_:

• d2cgqa_ is new in SCOPe 2.04-stable
  
• d2cgqa_ appears in SCOPe 2.05
  
• d2cgqa_ appears in the current release, SCOPe 2.08, called d2cgqa1