Lineage for d2cgqa1 (2cgq A:1-73)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706108Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 2706109Superfamily a.28.1: ACP-like [47336] (4 families) (S)
  5. 2706248Family a.28.1.0: automated matches [191582] (1 protein)
    not a true family
  6. 2706249Protein automated matches [191038] (29 species)
    not a true protein
  7. 2706314Species Mycobacterium tuberculosis [TaxId:83332] [255086] (1 PDB entry)
  8. 2706315Domain d2cgqa1: 2cgq A:1-73 [241452]
    Other proteins in same PDB: d2cgqa2
    automated match to d2ehta_

Details for d2cgqa1

PDB Entry: 2cgq (more details), 1.83 Å

PDB Description: a putative acyl carrier protein(rv0033) from mycobacterium tuberculosis
PDB Compounds: (A:) acyl carrier protein acpa

SCOPe Domain Sequences for d2cgqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cgqa1 a.28.1.0 (A:1-73) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
meeainatiqrilrtdrgitanqvlvddlgfdslklfqliteledefdiaisfrdaqnik
tvgdvytsvavwf

SCOPe Domain Coordinates for d2cgqa1:

Click to download the PDB-style file with coordinates for d2cgqa1.
(The format of our PDB-style files is described here.)

Timeline for d2cgqa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2cgqa2