| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies) 4 helices, bundle; helix 3 is shorter than others; up-and-down |
Superfamily a.28.1: ACP-like [47336] (4 families) ![]() |
| Family a.28.1.0: automated matches [191582] (1 protein) not a true family |
| Protein automated matches [191038] (29 species) not a true protein |
| Species Mycobacterium tuberculosis [TaxId:83332] [255086] (1 PDB entry) |
| Domain d2cgqa1: 2cgq A:1-73 [241452] Other proteins in same PDB: d2cgqa2 automated match to d2ehta_ |
PDB Entry: 2cgq (more details), 1.83 Å
SCOPe Domain Sequences for d2cgqa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cgqa1 a.28.1.0 (A:1-73) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
meeainatiqrilrtdrgitanqvlvddlgfdslklfqliteledefdiaisfrdaqnik
tvgdvytsvavwf
Timeline for d2cgqa1: