SCOPe 2.07: Domain d2cgqa1: 2cgq A:1-73

Lineage for d2cgqa1 (2cgq A:1-73)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
   4 helices, bundle; helix 3 is shorter than others; up-and-down

4. Superfamily a.28.1: ACP-like [47336] (4 families)

5. Family a.28.1.0: automated matches [191582] (1 protein)
   not a true family

6. Protein automated matches [191038] (20 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:83332] [255086] (1 PDB entry)

8. Domain d2cgqa1: 2cgq A:1-73 [241452]
   Other proteins in same PDB: d2cgqa2
   automated match to d2ehta_

Details for d2cgqa1

PDB Entry: 2cgq, 1.83 Å

PDB Description: a putative acyl carrier protein(rv0033) from mycobacterium tuberculosis

PDB Compounds: (A:) acyl carrier protein acpa

SCOPe Domain Sequences for d2cgqa1:

Sequence; same for both SEQRES and ATOM records:

>d2cgqa1 a.28.1.0 (A:1-73) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
meeainatiqrilrtdrgitanqvlvddlgfdslklfqliteledefdiaisfrdaqnik
tvgdvytsvavwf

Timeline for d2cgqa1:

• d2cgqa1 first appeared in SCOPe 2.04, called d2cgqa_
  
• d2cgqa1 appears in SCOPe 2.06