Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) Similar in architecture to the superfamily I but partly differs in topology |
Family c.94.1.1: Phosphate binding protein-like [53851] (42 proteins) |
Protein Sialic acid-binding protein SiaP [254345] (1 species) Pfam PF03480; TRAP transporter; homology to other Type II ESRs (Extracytoplasmic solute receptors) discussed in PubMed 16702222 |
Species Haemophilus influenzae [TaxId:727] [254778] (6 PDB entries) |
Domain d2ceya_: 2cey A: [241451] complexed with zn |
PDB Entry: 2cey (more details), 1.7 Å
SCOPe Domain Sequences for d2ceya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ceya_ c.94.1.1 (A:) Sialic acid-binding protein SiaP {Haemophilus influenzae [TaxId: 727]} adydlkfgmnagtssneykaaemfakevkeksqgkieislypssqlgddramlkqlkdgs ldftfaesarfqlfypeaavfalpyvisnynvaqkalfdtefgkdlikkmdkdlgvtlls qayngtrqttsnrainsiadmkglklrvpnaatnlayakyvgasptpmafsevylalqtn avdgqenplaavqaqkfyevqkflamtnhilndqlylvsnetykelpedlqkvvkdaaen aakyhtklfvdgekdlvtffekqgvkithpdlvpfkesmkpyyaefvkqtgqkgesalkq ieainp
Timeline for d2ceya_: