SCOPe 2.04: Domain d2ceya_: 2cey A:

Lineage for d2ceya_ (2cey A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (42 proteins)

6. Protein Sialic acid-binding protein SiaP [254345] (1 species)
   Pfam PF03480; TRAP transporter; homology to other Type II ESRs (Extracytoplasmic solute receptors) discussed in PubMed 16702222

7. Species Haemophilus influenzae [TaxId:727] [254778] (6 PDB entries)

8. Domain d2ceya_: 2cey A: [241451]
   complexed with zn

Details for d2ceya_

PDB Entry: 2cey, 1.7 Å

PDB Description: apo structure of siap

PDB Compounds: (A:) protein hi0146

SCOPe Domain Sequences for d2ceya_:

Sequence; same for both SEQRES and ATOM records:

>d2ceya_ c.94.1.1 (A:) Sialic acid-binding protein SiaP {Haemophilus influenzae [TaxId: 727]}
adydlkfgmnagtssneykaaemfakevkeksqgkieislypssqlgddramlkqlkdgs
ldftfaesarfqlfypeaavfalpyvisnynvaqkalfdtefgkdlikkmdkdlgvtlls
qayngtrqttsnrainsiadmkglklrvpnaatnlayakyvgasptpmafsevylalqtn
avdgqenplaavqaqkfyevqkflamtnhilndqlylvsnetykelpedlqkvvkdaaen
aakyhtklfvdgekdlvtffekqgvkithpdlvpfkesmkpyyaefvkqtgqkgesalkq
ieainp

Timeline for d2ceya_:

• d2ceya_ is new in SCOPe 2.04-stable
  
• d2ceya_ appears in SCOPe 2.05
  
• d2ceya_ appears in the current release, SCOPe 2.08