Lineage for d2cexc_ (2cex C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2913609Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
    has additional insertions and/or extensions that are not grouped together
  6. 2914644Protein Sialic acid-binding protein SiaP [254345] (1 species)
    Pfam PF03480; TRAP transporter; homology to other Type II ESRs (Extracytoplasmic solute receptors) discussed in PubMed 16702222
  7. 2914645Species Haemophilus influenzae [TaxId:727] [254778] (7 PDB entries)
  8. 2914654Domain d2cexc_: 2cex C: [241449]
    automated match to d2ceya_
    complexed with dan, gol, zn

    has additional insertions and/or extensions that are not grouped together

Details for d2cexc_

PDB Entry: 2cex (more details), 2.2 Å

PDB Description: structure of a sialic acid binding protein (siap) in the presence of the sialic acid acid analogue neu5ac2en
PDB Compounds: (C:) protein hi0146

SCOPe Domain Sequences for d2cexc_:

Sequence, based on SEQRES records: (download)

>d2cexc_ c.94.1.1 (C:) Sialic acid-binding protein SiaP {Haemophilus influenzae [TaxId: 727]}
dydlkfgmnagtssneykaaemfakevkeksqgkieislypssqlgddramlkqlkdgsl
dftfaesarfqlfypeaavfalpyvisnynvaqkalfdtefgkdlikkmdkdlgvtllsq
ayngtrqttsnrainsiadmkglklrvpnaatnlayakyvgasptpmafsevylalqtna
vdgqenplaavqaqkfyevqkflamtnhilndqlylvsnetykelpedlqkvvkdaaena
akyhtklfvdgekdlvtffekqgvkithpdlvpfkesmkpyyaefvkqtgqkgesalkqi
eain

Sequence, based on observed residues (ATOM records): (download)

>d2cexc_ c.94.1.1 (C:) Sialic acid-binding protein SiaP {Haemophilus influenzae [TaxId: 727]}
dydlkfgmnagtssneykaaemfakevkekieislypssqlgddramlkqlkdgsldftf
aesarfqlfypeaavfalpyvisnynvaqkalfdtefgkdlikkmdkdlgvtllsqayng
trqttsnrainsiadmkglklrvpnaatnlayakyvgasptpmafsevylalqtnavdgq
enplaavqaqkfyevqkflamtnhilndqlylvsnetykelpedlqkvvkdaaenaakyh
tklfvdgekdlvtffekqgvkithpdlvpfkesmkpyyaefvkqtgqkgesalkqieain

SCOPe Domain Coordinates for d2cexc_:

Click to download the PDB-style file with coordinates for d2cexc_.
(The format of our PDB-style files is described here.)

Timeline for d2cexc_: