Class a: All alpha proteins [46456] (286 folds) |
Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
Superfamily a.104.1: Cytochrome P450 [48264] (2 families) |
Family a.104.1.0: automated matches [191509] (1 protein) not a true family |
Protein automated matches [190847] (45 species) not a true protein |
Species Streptomyces venezuelae [TaxId:54571] [255065] (14 PDB entries) |
Domain d2ca0b_: 2ca0 B: [241443] automated match to d4dnja_ complexed with hem, pxi |
PDB Entry: 2ca0 (more details), 2.85 Å
SCOPe Domain Sequences for d2ca0b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ca0b_ a.104.1.0 (B:) automated matches {Streptomyces venezuelae [TaxId: 54571]} vldlgalgqdfaadpyptyarlraegpahrvrtpegdevwlvvgydraravladprfskd wrnsttplteaeaalnhnmlesdpprhtrlrklvareftmrrvellrprvqeivdglvda mlaapdgradlmeslawplpitvisellgvpepdraafrvwtdafvfpddpaqaqtamae msgylsrlidskrgqdgedllsalvrtsdedgsrltseellgmahillvaghettvnlia ngmyallshpdqlaalradmtlldgaveemlryegpvesatyrfpvepvdldgtvipagd tvlvvladahrtperfpdphrfdirrdtaghlafghgihfcigaplarleariavralle rcpdlaldvspgelvwypnpmirglkalpirwr
Timeline for d2ca0b_: