Lineage for d2c8th_ (2c8t H:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1584360Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 1584361Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 1585212Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 1585213Protein automated matches [190246] (46 species)
    not a true protein
  7. 1585523Species Mycobacterium tuberculosis [TaxId:83332] [187022] (7 PDB entries)
  8. 1585569Domain d2c8th_: 2c8t H: [241435]
    automated match to d2cbyd_

Details for d2c8th_

PDB Entry: 2c8t (more details), 3 Å

PDB Description: the 3.0 a resolution structure of caseinolytic clp protease 1 from mycobacterium tuberculosis
PDB Compounds: (H:) ATP-dependent clp protease proteolytic subunit 1

SCOPe Domain Sequences for d2c8th_:

Sequence, based on SEQRES records: (download)

>d2c8th_ c.14.1.0 (H:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
sltdsvyerllseriiflgsevndeianrlcaqilllaaedaskdislyinspggsisag
maiydtmvlapcdiatyamgmaasmgefllaagtkgkryalpharilmhqplggvtgsaa
diaiqaeqfavikkemfrlnaeftgqpierieadsdrdrwftaaealeygfvdhiitrah

Sequence, based on observed residues (ATOM records): (download)

>d2c8th_ c.14.1.0 (H:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
sltdsvyerllseriiflgsevndeianrlcaqilllaaedaskdislyinspggsisag
maiydtmvlapcdiatyamgmaasmgefllaagtkgkryalpharilmhqpliaiqaeqf
avikkemfrlnaeftgqpierieadsdrdrwftaaealeygfvdhiitrah

SCOPe Domain Coordinates for d2c8th_:

Click to download the PDB-style file with coordinates for d2c8th_.
(The format of our PDB-style files is described here.)

Timeline for d2c8th_: