Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
Superfamily c.14.1: ClpP/crotonase [52096] (5 families) |
Family c.14.1.0: automated matches [191346] (1 protein) not a true family |
Protein automated matches [190246] (46 species) not a true protein |
Species Mycobacterium tuberculosis [TaxId:83332] [187022] (7 PDB entries) |
Domain d2c8th_: 2c8t H: [241435] automated match to d2cbyd_ |
PDB Entry: 2c8t (more details), 3 Å
SCOPe Domain Sequences for d2c8th_:
Sequence, based on SEQRES records: (download)
>d2c8th_ c.14.1.0 (H:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]} sltdsvyerllseriiflgsevndeianrlcaqilllaaedaskdislyinspggsisag maiydtmvlapcdiatyamgmaasmgefllaagtkgkryalpharilmhqplggvtgsaa diaiqaeqfavikkemfrlnaeftgqpierieadsdrdrwftaaealeygfvdhiitrah
>d2c8th_ c.14.1.0 (H:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]} sltdsvyerllseriiflgsevndeianrlcaqilllaaedaskdislyinspggsisag maiydtmvlapcdiatyamgmaasmgefllaagtkgkryalpharilmhqpliaiqaeqf avikkemfrlnaeftgqpierieadsdrdrwftaaealeygfvdhiitrah
Timeline for d2c8th_: