![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.5: Inosine monophosphate dehydrogenase (IMPDH) [51412] (2 families) ![]() The phosphate moiety of substrate binds in the 'common' phosphate-binding site |
![]() | Family c.1.5.0: automated matches [227276] (1 protein) not a true family |
![]() | Protein automated matches [227084] (16 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [230557] (5 PDB entries) |
![]() | Domain d2c6qh1: 2c6q H:10-336 [241424] Other proteins in same PDB: d2c6qa2, d2c6qb2, d2c6qc2, d2c6qd2, d2c6qe2, d2c6qf2, d2c6qg2, d2c6qh2 automated match to d2bzna_ complexed with imp, ndp |
PDB Entry: 2c6q (more details), 1.7 Å
SCOPe Domain Sequences for d2c6qh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c6qh1 c.1.5.0 (H:10-336) automated matches {Human (Homo sapiens) [TaxId: 9606]} ldfkdvllrpkrstlksrsevdltrsfsfrnskqtysgvpiiaanmdtvgtfemakvlck fslftavhkhyslvqwqefagqnpdclehlaassgtgssdfeqleqileaipqvkyicld vangysehfvefvkdvrkrfpqhtimagnvvtgemveelilsgadiikvgigpgsvcttr kktgvgypqlsavmecadaahglkghiisdggcscpgdvakafgagadfvmlggmlaghs esggelierdgkkyklfygmssemamkkyaggvaeyrasegktvevpfkgdvehtirdil ggirstctyvgaaklkelsrrttfirv
Timeline for d2c6qh1: