SCOPe 2.03: Domain d1qoob_: 1qoo B:

Lineage for d1qoob_ (1qoo B:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.1: Legume lectins [49900] (5 proteins)

6. Protein Legume lectin [49904] (23 species)

7. Species Furze (Ulex europaeus), UEA-II [TaxId:3902] [49918] (5 PDB entries)

8. Domain d1qoob_: 1qoo B: [24142]
   complexed with ca, mn, nag

Details for d1qoob_

PDB Entry: 1qoo, 2.75 Å

PDB Description: lectin uea-ii complexed with nag

PDB Compounds: (B:) chitin binding lectin, uea-II

SCOPe Domain Sequences for d1qoob_:

Sequence; same for both SEQRES and ATOM records:

>d1qoob_ b.29.1.1 (B:) Legume lectin {Furze (Ulex europaeus), UEA-II [TaxId: 3902]}
sddlsfnfdkfvpnqkniifqgdasvsttgvlqvtkvskptttsigralyaapiqiwdsi
tgkvasfatsfsfvvkadksdgvdglafflapansqipsgssagmfglfsssdskssnqi
iavefdtyfgkaynpwdpdfkhigidvnsiksiktvkwdwrngevadvvityraptkslt
vclsypsdgtsniitasvdlkailpewvsvgfsggvgnaaefethdvlswyftsnle

Timeline for d1qoob_:

• d1qoob_ first appeared (with stable ids) in SCOP 1.55
  
• d1qoob_ appears in SCOPe 2.02
  
• d1qoob_ appears in SCOPe 2.04
  
• d1qoob_ appears in the current release, SCOPe 2.08