Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) |
Family d.92.1.0: automated matches [191495] (1 protein) not a true family |
Protein automated matches [190805] (14 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188286] (36 PDB entries) |
Domain d2c6na_: 2c6n A: [241415] automated match to d4bzsa_ complexed with act, cl, gol, lpr, nag, ndg, zn |
PDB Entry: 2c6n (more details), 3 Å
SCOPe Domain Sequences for d2c6na_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c6na_ d.92.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} ldpglqpgnfsadeagaqlfaqsynssaeqvlfqsvaaswahdtnitaenarrqeeaall sqefaeawgqkakelyepiwqnftdpqlrriigavrtlgsanlplakrqqynallsnmsr iystakvclpnktatcwsldpdltnilassrsyamllfawegwhnaagiplkplyedfta lsneaykqdgftdtgaywrswynsptfeddlehlyqqleplylnlhafvrralhrrygdr yinlrgpipahllgdmwaqsweniydmvvpfpdkpnldvtstmlqqgwnathmfrvaeef ftslelspmppefwegsmlekpadgrevvchasawdfynrkdfrikqctrvtmdqlstvh hemghiqyylqykdlpvslrrganpgfheaigdvlalsvstpehlhkiglldrvtndtes dinyllkmalekiaflpfgylvdqwrwgvfsgrtppsrynfdwwylrtkyqgicppvtrn ethfdagakfhvpnvtpyiryfvsfvlqfqfhealckeagyegplhqcdiyrstkagakl rkvlqagssrpwqevlkdmvgldaldaqpllkyfqpvtqwlqeqnqqngevlgwpeyqwh pplpdnypegid
Timeline for d2c6na_: