SCOPe 2.08: Domain d2c46b1: 2c46 B:4-199

Lineage for d2c46b1 (2c46 B:4-199)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423

4. Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families)
   share with the family I the common active site structure with a circularly permuted topology

5. Family c.45.1.1: Dual specificity phosphatase-like [52800] (9 proteins)

6. Protein automated matches [190696] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188122] (16 PDB entries)

8. Domain d2c46b1: 2c46 B:4-199 [241408]
   Other proteins in same PDB: d2c46a2, d2c46b2, d2c46c2
   automated match to d1i9ta_

Details for d2c46b1

PDB Entry: 2c46, 1.6 Å

PDB Description: crystal structure of the human rna guanylyltransferase and 5'- phosphatase

PDB Compounds: (B:) mRNA capping enzyme

SCOPe Domain Sequences for d2c46b1:

Sequence, based on SEQRES records:

>d2c46b1 c.45.1.1 (B:4-199) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nkipprwlncprrgqpvagrflplktmlgprydsqvaeenrfhpsmlsnylkslkvkmgl
lvdltntsrfydrndiekegikyiklqckghgecpttentetfirlcerfnernppelig
vhcthgfnrtgflicaflvekmdwsieaavatfaqarppgiykgdylkelfrrygdieea
ppppllpdwcfedded

Sequence, based on observed residues (ATOM records):

>d2c46b1 c.45.1.1 (B:4-199) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nkipprwlncprrgqpvagrflplktmlgprydsqvaeenrfhpsmlsnylkslkvkmgl
lvdltntsrfydrndiekegikyiklqckghgecpttentetfirlcerfnerneligvh
cthgfnrtgflicaflvekmdwsieaavatfaqarppgiykgdylkelfrrygdieeapp
ppllpdwcfedded

Timeline for d2c46b1:

• d2c46b1 first appeared in SCOPe 2.04, called d2c46b_
  
• d2c46b1 appears in SCOPe 2.07