SCOPe 2.06: Domain d2c2fa_: 2c2f A:

Lineage for d2c2fa_ (2c2f A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.0: automated matches [191307] (1 protein)
   not a true family

6. Protein automated matches [190036] (39 species)
   not a true protein

7. Species Deinococcus radiodurans [TaxId:243230] [255080] (2 PDB entries)

8. Domain d2c2fa_: 2c2f A: [241405]
   automated match to d3ak8f_
   complexed with fe, gol, so4, zn

Details for d2c2fa_

PDB Entry: 2c2f, 1.61 Å

PDB Description: dps from deinococcus radiodurans

PDB Compounds: (A:) DNA-binding stress response protein

SCOPe Domain Sequences for d2c2fa_:

Sequence; same for both SEQRES and ATOM records:

>d2c2fa_ a.25.1.0 (A:) automated matches {Deinococcus radiodurans [TaxId: 243230]}
ggadhadaahlgtvnnalvnhhyleekefqtvaetlqrnlattislylkfkkyhwdirgr
ffrdlhlaydefiaeifpsideqaerlvalggsplaapadlarystvqvpqetvrdartq
vadlvqdlsrvgkgyrddsqacdeandpvtadmyngyaatidkirwmlqaimdderld

Timeline for d2c2fa_:

• d2c2fa_ first appeared in SCOPe 2.04
  
• d2c2fa_ appears in SCOPe 2.05
  
• d2c2fa_ appears in SCOPe 2.07
  
• d2c2fa_ appears in the current release, SCOPe 2.08