![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
![]() | Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
![]() | Family a.25.1.0: automated matches [191307] (1 protein) not a true family |
![]() | Protein automated matches [190036] (60 species) not a true protein |
![]() | Species Deinococcus radiodurans [TaxId:243230] [255080] (2 PDB entries) |
![]() | Domain d2c2fa_: 2c2f A: [241405] automated match to d3ak8f_ complexed with fe, gol, so4, zn |
PDB Entry: 2c2f (more details), 1.61 Å
SCOPe Domain Sequences for d2c2fa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c2fa_ a.25.1.0 (A:) automated matches {Deinococcus radiodurans [TaxId: 243230]} ggadhadaahlgtvnnalvnhhyleekefqtvaetlqrnlattislylkfkkyhwdirgr ffrdlhlaydefiaeifpsideqaerlvalggsplaapadlarystvqvpqetvrdartq vadlvqdlsrvgkgyrddsqacdeandpvtadmyngyaatidkirwmlqaimdderld
Timeline for d2c2fa_: