SCOPe 2.04: Domain d2c29f_: 2c29 F:

Lineage for d2c29f_ (2c29 F:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (181 species)
   not a true protein

7. Species Grape (Vitis vinifera) [TaxId:29760] [255079] (11 PDB entries)

8. Domain d2c29f_: 2c29 F: [241404]
   automated match to d2p4hx_
   complexed with dqh, nap

Details for d2c29f_

PDB Entry: 2c29, 1.81 Å

PDB Description: structure of dihydroflavonol reductase from vitis vinifera at 1.8 a.

PDB Compounds: (F:) dihydroflavonol 4-reductase

SCOPe Domain Sequences for d2c29f_:

Sequence; same for both SEQRES and ATOM records:

>d2c29f_ c.2.1.0 (F:) automated matches {Grape (Vitis vinifera) [TaxId: 29760]}
setvcvtgasgfigswlvmrllergytvratvrdptnvkkvkhlldlpkaethltlwkad
ladegsfdeaikgctgvfhvatpmdfeskdpenevikptiegmlgimkscaaaktvrrlv
ftssagtvniqehqlpvydescwsdmefcrakkmtawmyfvsktlaeqaawkyakennid
fitiiptlvvgpfimssmppslitalspitgneahysiirqgqfvhlddlcnahiylfen
pkaegryicsshdciildlakmlrekypeyniptefkgvdenlksvcfsskkltdlgfef
kysledmftgavdtcrakgllppshe

Timeline for d2c29f_:

• d2c29f_ is new in SCOPe 2.04-stable
  
• d2c29f_ appears in SCOPe 2.05
  
• d2c29f_ appears in the current release, SCOPe 2.08