Lineage for d2c00b3 (2c00 B:331-445)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2817437Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 2817540Superfamily b.84.2: Rudiment single hybrid motif [51246] (3 families) (S)
  5. 2817665Family b.84.2.0: automated matches [254217] (1 protein)
    not a true family
  6. 2817666Protein automated matches [254496] (16 species)
    not a true protein
  7. 2817722Species Pseudomonas aeruginosa [TaxId:287] [255074] (2 PDB entries)
  8. 2817724Domain d2c00b3: 2c00 B:331-445 [241402]
    Other proteins in same PDB: d2c00a1, d2c00a2, d2c00b1, d2c00b2
    automated match to d2w70a3
    complexed with so4

Details for d2c00b3

PDB Entry: 2c00 (more details), 2.5 Å

PDB Description: crystal structure of biotin carboxylase from pseudomonas aeruginosa in apo form
PDB Compounds: (B:) biotin carboxylase

SCOPe Domain Sequences for d2c00b3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c00b3 b.84.2.0 (B:331-445) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
rghalecrinaedpktfmpspgkvkhfhapggngvrvdshlysgysvppnydslvgkvit
ygadrdealarmrnaldelivdgiktntelhkdlvrdaafckggvnihylekklg

SCOPe Domain Coordinates for d2c00b3:

Click to download the PDB-style file with coordinates for d2c00b3.
(The format of our PDB-style files is described here.)

Timeline for d2c00b3: