![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies) sandwich of half-barrel shaped beta-sheets |
![]() | Superfamily b.84.2: Rudiment single hybrid motif [51246] (3 families) ![]() |
![]() | Family b.84.2.0: automated matches [254217] (1 protein) not a true family |
![]() | Protein automated matches [254496] (16 species) not a true protein |
![]() | Species Pseudomonas aeruginosa [TaxId:287] [255074] (2 PDB entries) |
![]() | Domain d2c00b3: 2c00 B:331-445 [241402] Other proteins in same PDB: d2c00a1, d2c00a2, d2c00b1, d2c00b2 automated match to d2w70a3 complexed with so4 |
PDB Entry: 2c00 (more details), 2.5 Å
SCOPe Domain Sequences for d2c00b3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c00b3 b.84.2.0 (B:331-445) automated matches {Pseudomonas aeruginosa [TaxId: 287]} rghalecrinaedpktfmpspgkvkhfhapggngvrvdshlysgysvppnydslvgkvit ygadrdealarmrnaldelivdgiktntelhkdlvrdaafckggvnihylekklg
Timeline for d2c00b3: