SCOPe 2.04: Domain d2c00b2: 2c00 B:115-330

Lineage for d2c00b2 (2c00 B:115-330)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.142: ATP-grasp [56058] (2 superfamilies)
   Consists of two subdomains with different alpha+beta folds
   shares functional and structural similarities with the PIPK and protein kinase superfamilies

4. Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (10 families)

5. Family d.142.1.0: automated matches [227184] (1 protein)
   not a true family

6. Protein automated matches [226904] (25 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:287] [255073] (2 PDB entries)

8. Domain d2c00b2: 2c00 B:115-330 [241401]
   Other proteins in same PDB: d2c00a1, d2c00a3, d2c00b1, d2c00b3
   automated match to d2w70a2
   complexed with so4

Details for d2c00b2

PDB Entry: 2c00, 2.5 Å

PDB Description: crystal structure of biotin carboxylase from pseudomonas aeruginosa in apo form

PDB Compounds: (B:) biotin carboxylase

SCOPe Domain Sequences for d2c00b2:

Sequence, based on SEQRES records:

>d2c00b2 d.142.1.0 (B:115-330) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
dkvsakdamkragvptvpgsdgplpedeetalaiarevgypviikaagggggrgmrvvyd
eseliksakltrteagaafgnpmvylekfltnprhvevqvlsdgqgnaihlgdrdcslqr
rhqkvieeapapgidekarqevfarcvqacieigyrgagtfeflyengrfyfiemntrvq
vehpvsemvtgvdivkemlriasgeklsirqedvvi

Sequence, based on observed residues (ATOM records):

>d2c00b2 d.142.1.0 (B:115-330) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
dkvsakdamkragvptvpgsdgplpedeetalaiarevgypviikaagggmrvvydesel
iksakltrteagagnpmvylekfltnprhvevqvlsdgqgnaihlgdrdcslqrrhqkvi
eeapapgidekarqevfarcvqacieigyrgagtfeflyengrfyfiemntrvqvehpvs
emvtgvdivkemlriasgeklsirqedvvi

Timeline for d2c00b2:

• d2c00b2 is new in SCOPe 2.04-stable
  
• d2c00b2 appears in SCOPe 2.05
  
• d2c00b2 appears in the current release, SCOPe 2.08