SCOPe 2.08: Domain d2c00b1: 2c00 B:1-114

Lineage for d2c00b1 (2c00 B:1-114)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
   3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
   possible rudiment form of Rossmann-fold domain

4. Superfamily c.30.1: PreATP-grasp domain [52440] (10 families)
   precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function

5. Family c.30.1.0: automated matches [227183] (1 protein)
   not a true family

6. Protein automated matches [226903] (40 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:287] [255072] (2 PDB entries)

8. Domain d2c00b1: 2c00 B:1-114 [241400]
   Other proteins in same PDB: d2c00a2, d2c00a3, d2c00b2, d2c00b3
   automated match to d2w70a1
   complexed with so4

Details for d2c00b1

PDB Entry: 2c00, 2.5 Å

PDB Description: crystal structure of biotin carboxylase from pseudomonas aeruginosa in apo form

PDB Compounds: (B:) biotin carboxylase

SCOPe Domain Sequences for d2c00b1:

Sequence; same for both SEQRES and ATOM records:

>d2c00b1 c.30.1.0 (B:1-114) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
mlekvlianrgeialrilrackelgiktvavhstadrelmhlsladesvcigpapatqsy
lqipaiiaaaevtgataihpgygflaenadfaeqiersgftfvgptaevirlmg

Timeline for d2c00b1:

• d2c00b1 first appeared in SCOPe 2.04
  
• d2c00b1 appears in SCOPe 2.07