Lineage for d1qnwd_ (1qnw D:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 371122Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 371123Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (20 families) (S)
  5. 371124Family b.29.1.1: Legume lectins [49900] (4 proteins)
  6. 371251Protein Legume lectin [49904] (23 species)
  7. 371312Species Furze (Ulex europaeus), UEA-II [TaxId:3902] [49918] (5 PDB entries)
  8. 371316Domain d1qnwd_: 1qnw D: [24140]

Details for d1qnwd_

PDB Entry: 1qnw (more details), 2.35 Å

PDB Description: lectin ii from ulex europaeus

SCOP Domain Sequences for d1qnwd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qnwd_ b.29.1.1 (D:) Legume lectin {Furze (Ulex europaeus), UEA-II}
sddlsfnfdkfvpnqkniifqgdasvsttgvlqvtkvskptttsigralyaapiqiwdsi
tgkvasfatsfsfvvkadksdgvdglafflapansqipsgssagmfglfsssdskssnqi
iavefdtyfgkaynpwdpdfkhigidvnsiksiktvkwdwrngevadvvityraptkslt
vclsypsdgtsniitasvdlkailpewvsvgfsggvgnaaefethdvlswyftsnle

SCOP Domain Coordinates for d1qnwd_:

Click to download the PDB-style file with coordinates for d1qnwd_.
(The format of our PDB-style files is described here.)

Timeline for d1qnwd_: