Lineage for d2c00a2 (2c00 A:115-330)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2217268Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 2217269Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) (S)
  5. 2217671Family d.142.1.0: automated matches [227184] (1 protein)
    not a true family
  6. 2217672Protein automated matches [226904] (32 species)
    not a true protein
  7. 2217758Species Pseudomonas aeruginosa [TaxId:287] [255073] (2 PDB entries)
  8. 2217760Domain d2c00a2: 2c00 A:115-330 [241398]
    Other proteins in same PDB: d2c00a1, d2c00a3, d2c00b1, d2c00b3
    automated match to d2w70a2
    complexed with so4

Details for d2c00a2

PDB Entry: 2c00 (more details), 2.5 Å

PDB Description: crystal structure of biotin carboxylase from pseudomonas aeruginosa in apo form
PDB Compounds: (A:) biotin carboxylase

SCOPe Domain Sequences for d2c00a2:

Sequence, based on SEQRES records: (download)

>d2c00a2 d.142.1.0 (A:115-330) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
dkvsakdamkragvptvpgsdgplpedeetalaiarevgypviikaagggggrgmrvvyd
eseliksakltrteagaafgnpmvylekfltnprhvevqvlsdgqgnaihlgdrdcslqr
rhqkvieeapapgidekarqevfarcvqacieigyrgagtfeflyengrfyfiemntrvq
vehpvsemvtgvdivkemlriasgeklsirqedvvi

Sequence, based on observed residues (ATOM records): (download)

>d2c00a2 d.142.1.0 (A:115-330) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
dkvsakdamkragvptvpgsdgplpedeetalaiarevgypviikaaggrgmrvvydese
liksakltrteagfgnpmvylekfltnprhvevqvlsdgqgnaihlgdrdcslqrrhqkv
ieeapapgidekarqevfarcvqacieigyrgagtfeflyengrfyfiemntrvqvehpv
semvtgvdivkemlriasgeklsirqedvvi

SCOPe Domain Coordinates for d2c00a2:

Click to download the PDB-style file with coordinates for d2c00a2.
(The format of our PDB-style files is described here.)

Timeline for d2c00a2: