![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.159: Another 3-helical bundle [81602] (5 superfamilies) topologically similar to the DNA/RNA-binding bundles; distinct packing |
![]() | Superfamily a.159.5: IscX-like [140319] (1 family) ![]() automatically mapped to Pfam PF04384 |
![]() | Family a.159.5.1: IscX-like [140320] (2 proteins) Pfam PF04384; DUF528 |
![]() | Protein automated matches [254495] (1 species) not a true protein |
![]() | Species Escherichia coli K-12 [TaxId:83333] [255071] (1 PDB entry) |
![]() | Domain d2bzta_: 2bzt A: [241396] automated match to d1uj8a1 |
PDB Entry: 2bzt (more details)
SCOPe Domain Sequences for d2bzta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bzta_ a.159.5.1 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]} mglkwtdsreigealydaypdldpktvrftdmhqwicdledfdddpqasnekileaillv wldeae
Timeline for d2bzta_: