Lineage for d2bzta_ (2bzt A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2735563Fold a.159: Another 3-helical bundle [81602] (5 superfamilies)
    topologically similar to the DNA/RNA-binding bundles; distinct packing
  4. 2735610Superfamily a.159.5: IscX-like [140319] (1 family) (S)
    automatically mapped to Pfam PF04384
  5. 2735611Family a.159.5.1: IscX-like [140320] (2 proteins)
    Pfam PF04384; DUF528
  6. 2735615Protein automated matches [254495] (1 species)
    not a true protein
  7. 2735616Species Escherichia coli K-12 [TaxId:83333] [255071] (1 PDB entry)
  8. 2735617Domain d2bzta_: 2bzt A: [241396]
    automated match to d1uj8a1

Details for d2bzta_

PDB Entry: 2bzt (more details)

PDB Description: nmr structure of the bacterial protein yfhj from e. coli
PDB Compounds: (A:) protein iscx

SCOPe Domain Sequences for d2bzta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bzta_ a.159.5.1 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
mglkwtdsreigealydaypdldpktvrftdmhqwicdledfdddpqasnekileaillv
wldeae

SCOPe Domain Coordinates for d2bzta_:

Click to download the PDB-style file with coordinates for d2bzta_.
(The format of our PDB-style files is described here.)

Timeline for d2bzta_: