| Class b: All beta proteins [48724] (177 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (24 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
| Family b.1.18.0: automated matches [191341] (1 protein) not a true family |
| Protein automated matches [190226] (55 species) not a true protein |
| Species Micromonospora viridifaciens [TaxId:1881] [254942] (4 PDB entries) |
| Domain d2bzdc2: 2bzd C:403-505 [241393] Other proteins in same PDB: d2bzda1, d2bzda3, d2bzdb1, d2bzdb3, d2bzdc1, d2bzdc3 automated match to d1w8oa1 complexed with gal, gol, na |
PDB Entry: 2bzd (more details), 2 Å
SCOPe Domain Sequences for d2bzdc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bzdc2 b.1.18.0 (C:403-505) automated matches {Micromonospora viridifaciens [TaxId: 1881]}
gicapftipdvalepgqqvtvpvavtnqsgiavpkpslqldaspdwqvqgsveplmpgrq
akgqvtitvpagttpgryrvgatlrtsagnasttftvtvglld
Timeline for d2bzdc2: