Lineage for d1qnwc_ (1qnw C:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2373039Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2373040Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2373041Family b.29.1.1: Legume lectins [49900] (5 protein domains)
  6. 2373210Protein Legume lectin [49904] (23 species)
  7. 2373287Species Furze (Ulex europaeus), UEA-II [TaxId:3902] [49918] (5 PDB entries)
  8. 2373290Domain d1qnwc_: 1qnw C: [24139]
    complexed with ca, mn, nag

Details for d1qnwc_

PDB Entry: 1qnw (more details), 2.35 Å

PDB Description: lectin ii from ulex europaeus
PDB Compounds: (C:) chitin binding lectin, uea-II

SCOPe Domain Sequences for d1qnwc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qnwc_ b.29.1.1 (C:) Legume lectin {Furze (Ulex europaeus), UEA-II [TaxId: 3902]}
sddlsfnfdkfvpnqkniifqgdasvsttgvlqvtkvskptttsigralyaapiqiwdsi
tgkvasfatsfsfvvkadksdgvdglafflapansqipsgssagmfglfsssdskssnqi
iavefdtyfgkaynpwdpdfkhigidvnsiksiktvkwdwrngevadvvityraptkslt
vclsypsdgtsniitasvdlkailpewvsvgfsggvgnaaefethdvlswyftsnle

SCOPe Domain Coordinates for d1qnwc_:

Click to download the PDB-style file with coordinates for d1qnwc_.
(The format of our PDB-style files is described here.)

Timeline for d1qnwc_: