Lineage for d2bysh_ (2bys H:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2408110Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 2408111Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) (S)
  5. 2408524Family b.96.1.0: automated matches [193505] (1 protein)
    not a true family
  6. 2408525Protein automated matches [193506] (4 species)
    not a true protein
  7. 2408526Species California sea hare (Aplysia californica) [TaxId:6500] [230583] (52 PDB entries)
  8. 2408689Domain d2bysh_: 2bys H: [241383]
    Other proteins in same PDB: d2bysb2, d2bysd2, d2byse2, d2bysi2
    automated match to d2c9ta_
    complexed with lob

Details for d2bysh_

PDB Entry: 2bys (more details), 2.05 Å

PDB Description: crystal structure of achbp from aplysia californica in complex with lobeline
PDB Compounds: (H:) acetylcholine-binding protein

SCOPe Domain Sequences for d2bysh_:

Sequence, based on SEQRES records: (download)

>d2bysh_ b.96.1.0 (H:) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]}
hsqanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkadsstnevdlvyyeqqrw
klnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipa
qrlsfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsat
qtrqvqhysccpepyidvnlvvkfrer

Sequence, based on observed residues (ATOM records): (download)

>d2bysh_ b.96.1.0 (H:) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]}
hsqanlmrlksdlfnrypgptkddpltvtlgftlqdivkadsstnevdlvyyeqqrwkln
slmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipaqrl
sfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsatqtr
qvqhysccpepyidvnlvvkfrer

SCOPe Domain Coordinates for d2bysh_:

Click to download the PDB-style file with coordinates for d2bysh_.
(The format of our PDB-style files is described here.)

Timeline for d2bysh_: