Lineage for d2bysg_ (2bys G:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2819475Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 2819476Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) (S)
  5. 2819945Family b.96.1.0: automated matches [193505] (1 protein)
    not a true family
  6. 2819946Protein automated matches [193506] (5 species)
    not a true protein
  7. 2819947Species California sea hare (Aplysia californica) [TaxId:6500] [230583] (67 PDB entries)
  8. 2820179Domain d2bysg_: 2bys G: [241382]
    Other proteins in same PDB: d2bysb2, d2bysd2, d2byse2, d2bysi2
    automated match to d2c9ta_
    complexed with lob

Details for d2bysg_

PDB Entry: 2bys (more details), 2.05 Å

PDB Description: crystal structure of achbp from aplysia californica in complex with lobeline
PDB Compounds: (G:) acetylcholine-binding protein

SCOPe Domain Sequences for d2bysg_:

Sequence, based on SEQRES records: (download)

>d2bysg_ b.96.1.0 (G:) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]}
hsqanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkadsstnevdlvyyeqqrw
klnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipa
qrlsfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsat
qtrqvqhysccpepyidvnlvvkfrerr

Sequence, based on observed residues (ATOM records): (download)

>d2bysg_ b.96.1.0 (G:) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]}
hsqanlmrlksdlfypgptkddpltvtlgftlqdivkadsstnevdlvyyeqqrwklnsl
mwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipaqrlsf
mcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsatqtrqv
qhysccpepyidvnlvvkfrerr

SCOPe Domain Coordinates for d2bysg_:

Click to download the PDB-style file with coordinates for d2bysg_.
(The format of our PDB-style files is described here.)

Timeline for d2bysg_: