Lineage for d1qnwa_ (1qnw A:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 12390Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
  4. 12391Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (11 families) (S)
  5. 12392Family b.29.1.1: Legume lectins [49900] (4 proteins)
  6. 12495Protein Lectin [49904] (15 species)
  7. 12521Species Furze (Ulex europaeus), UEA-II [TaxId:3902] [49918] (5 PDB entries)
  8. 12522Domain d1qnwa_: 1qnw A: [24137]

Details for d1qnwa_

PDB Entry: 1qnw (more details), 2.35 Å

PDB Description: lectin ii from ulex europaeus

SCOP Domain Sequences for d1qnwa_:

Sequence, based on SEQRES records: (download)

>d1qnwa_ b.29.1.1 (A:) Lectin {Furze (Ulex europaeus), UEA-II}
sddlsfnfdkfvpnqkniifqgdasvsttgvlqvtkvskptttsigralyaapiqiwdsi
tgkvasfatsfsfvvkadksdgvdglafflapansqipsgssagmfglfsssdskssnqi
iavefdtyfgkaynpwdpdfkhigidvnsiksiktvkwdwrngevadvvityraptkslt
vclsypsdgtsniitasvdlkailpewvsvgfsggvgnaaefethdvlswyftsnle

Sequence, based on observed residues (ATOM records): (download)

>d1qnwa_ b.29.1.1 (A:) Lectin {Furze (Ulex europaeus), UEA-II}
sddlsfnfdkfvpnqkniifqgdasvsttgvlqvtkvstttsigralyaapiqiwdsitg
kvasfatsfsfvvkadksdgvdglafflapansqipsgssagmfglfsssdskssnqiia
vefdtyfgkaynpwdpdfkhigidvnsiksiktvkwdwrngevadvvityraptksltvc
lsypsdgtsniitasvdlkailpewvsvgfsggvgnaaefethdvlswyftsnle

SCOP Domain Coordinates for d1qnwa_:

Click to download the PDB-style file with coordinates for d1qnwa_.
(The format of our PDB-style files is described here.)

Timeline for d1qnwa_: