Lineage for d1qnwa_ (1qnw A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2042196Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2042197Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2042198Family b.29.1.1: Legume lectins [49900] (5 protein domains)
  6. 2042364Protein Legume lectin [49904] (23 species)
  7. 2042441Species Furze (Ulex europaeus), UEA-II [TaxId:3902] [49918] (5 PDB entries)
  8. 2042442Domain d1qnwa_: 1qnw A: [24137]
    complexed with ca, mn, nag

Details for d1qnwa_

PDB Entry: 1qnw (more details), 2.35 Å

PDB Description: lectin ii from ulex europaeus
PDB Compounds: (A:) chitin binding lectin, uea-II

SCOPe Domain Sequences for d1qnwa_:

Sequence, based on SEQRES records: (download)

>d1qnwa_ b.29.1.1 (A:) Legume lectin {Furze (Ulex europaeus), UEA-II [TaxId: 3902]}
sddlsfnfdkfvpnqkniifqgdasvsttgvlqvtkvskptttsigralyaapiqiwdsi
tgkvasfatsfsfvvkadksdgvdglafflapansqipsgssagmfglfsssdskssnqi
iavefdtyfgkaynpwdpdfkhigidvnsiksiktvkwdwrngevadvvityraptkslt
vclsypsdgtsniitasvdlkailpewvsvgfsggvgnaaefethdvlswyftsnle

Sequence, based on observed residues (ATOM records): (download)

>d1qnwa_ b.29.1.1 (A:) Legume lectin {Furze (Ulex europaeus), UEA-II [TaxId: 3902]}
sddlsfnfdkfvpnqkniifqgdasvsttgvlqvtkvstttsigralyaapiqiwdsitg
kvasfatsfsfvvkadksdgvdglafflapansqipsgssagmfglfsssdskssnqiia
vefdtyfgkaynpwdpdfkhigidvnsiksiktvkwdwrngevadvvityraptksltvc
lsypsdgtsniitasvdlkailpewvsvgfsggvgnaaefethdvlswyftsnle

SCOPe Domain Coordinates for d1qnwa_:

Click to download the PDB-style file with coordinates for d1qnwa_.
(The format of our PDB-style files is described here.)

Timeline for d1qnwa_: