SCOPe 2.06: Domain d2bynd1: 2byn D:1-208

Lineage for d2bynd1 (2byn D:1-208)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds

4. Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families)

5. Family b.96.1.0: automated matches [193505] (1 protein)
   not a true family

6. Protein automated matches [193506] (6 species)
   not a true protein

7. Species California sea hare (Aplysia californica) [TaxId:6500] [230583] (48 PDB entries)

8. Domain d2bynd1: 2byn D:1-208 [241364]
   Other proteins in same PDB: d2byna2, d2bynb2, d2bync2, d2bynd2, d2byne2
   automated match to d2c9ta_
   complexed with 1pe, nag, pg4

Details for d2bynd1

PDB Entry: 2byn, 2.02 Å

PDB Description: crystal structure of apo achbp from aplysia californica

PDB Compounds: (D:) Soluble acetylcholine receptor

SCOPe Domain Sequences for d2bynd1:

Sequence, based on SEQRES records:

>d2bynd1 b.96.1.0 (D:1-208) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]}
hsqanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkadsstnevdlvyyeqqrw
klnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipa
qrlsfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsat
qtrqvqhysccpepyidvnlvvkfrerr

Sequence, based on observed residues (ATOM records):

>d2bynd1 b.96.1.0 (D:1-208) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]}
hsqanlmrlksdlfnrspypgptkddpltvtlgftlqdivkadsstnevdlvyyeqqrwk
lnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipaq
rlsfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsatq
trqvqhysccpepyidvnlvvkfrerr

Timeline for d2bynd1:

• d2bynd1 first appeared in SCOPe 2.04, called d2bynd_
  
• d2bynd1 was called d2bynd_ in SCOPe 2.05
  
• d2bynd1 appears in SCOPe 2.07
  
• d2bynd1 appears in the current release, SCOPe 2.08