Lineage for d2bvjb_ (2bvj B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2005528Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2005529Protein automated matches [190847] (63 species)
    not a true protein
  7. 2005933Species Streptomyces venezuelae [TaxId:54571] [255065] (14 PDB entries)
  8. 2005944Domain d2bvjb_: 2bvj B: [241360]
    automated match to d4dnja_
    complexed with bme, dtt, hem

Details for d2bvjb_

PDB Entry: 2bvj (more details), 2.1 Å

PDB Description: ligand-free structure of cytochrome p450 pikc (cyp107l1)
PDB Compounds: (B:) cytochrome p450 monooxygenase

SCOPe Domain Sequences for d2bvjb_:

Sequence, based on SEQRES records: (download)

>d2bvjb_ a.104.1.0 (B:) automated matches {Streptomyces venezuelae [TaxId: 54571]}
sppvldlgalgqdfaadpyptyarlraegpahrvrtpegdevwlvvgydraravladprf
skdwrnsttplteaeaalnhnmlesdpprhtrlrklvareftmrrvellrprvqeivdgl
vdamlaapdgradlmeslawplpitvisellgvpepdraafrvwtdafvfpddpaqaqta
maemsgylsrlidskrgqdgedllsalvrtsdedgsrltseellgmahillvaghettvn
liangmyallshpdqlaalradmtlldgaveemlryegpvesatyrfpvepvdldgtvip
agdtvlvvladahrtperfpdphrfdirrdtaghlafghgihfcigaplarleariavra
llercpdlaldvspgelvwypnpmirglkalpirwrrg

Sequence, based on observed residues (ATOM records): (download)

>d2bvjb_ a.104.1.0 (B:) automated matches {Streptomyces venezuelae [TaxId: 54571]}
sppvldlgalgqdfaadpyptyarlraegpahrvrtpegdevwlvvgydraravladprf
skdwrnsttpllnhnmlesdpprhtrlrklvareftmrrvellrprvqeivdglvdamla
apdgradlmeslawplpitvisellgvpepdraafrvwtdafvfpddpaqaqtamaemsg
ylsrlidskrgqdgedllsalvrtsdedgsrltseellgmahillvaghettvnliangm
yallshpdqlaalradmtlldgaveemlryegpvesatyrfpvepvdldgtvipagdtvl
vvladahrtperfpdphrfdirrdtaghlafghgihfcigaplarleariavrallercp
dlaldvspgelvwypnpmirglkalpirwrrg

SCOPe Domain Coordinates for d2bvjb_:

Click to download the PDB-style file with coordinates for d2bvjb_.
(The format of our PDB-style files is described here.)

Timeline for d2bvjb_: