SCOP 1.61: Domain d1fx5b_: 1fx5 B:

Lineage for d1fx5b_ (1fx5 B:)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (14 families)

5. Family b.29.1.1: Legume lectins [49900] (4 proteins)

6. Protein Legume lectin [49904] (20 species)

7. Species Furze (Ulex europaeus), UEA-I [TaxId:3902] [49917] (1 PDB entry)

8. Domain d1fx5b_: 1fx5 B: [24136]

Details for d1fx5b_

PDB Entry: 1fx5, 2.2 Å

PDB Description: crystal structure analysis of ulex europaeus lectin i

SCOP Domain Sequences for d1fx5b_:

Sequence; same for both SEQRES and ATOM records:

>d1fx5b_ b.29.1.1 (B:) Legume lectin {Furze (Ulex europaeus), UEA-I}
sddlsfkfknfsqngkdlsfqgnasvietgvlqlnkvgnnlpdetggiaryiapihiwnc
ntgelasfitsfsffmetsanpkaatdgltfflappdsplrraggyfglfndtkcdssyq
tvavefdtigspvnfwdpgfphigidvncvksinaerwnkryglnnvanveiiyeasskt
ltasltypsdqtsisvtsivdlkeilpewvsvgfsgstyigrqathevlnwyftstfin

Timeline for d1fx5b_:

• d1fx5b_ first appeared (with stable ids) in SCOP 1.55
  
• d1fx5b_ appears in SCOP 1.59
  
• d1fx5b_ appears in SCOP 1.63
  
• d1fx5b_ appears in the current release, SCOPe 2.08