Lineage for d1fx5b_ (1fx5 B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2778276Family b.29.1.1: Legume lectins [49900] (5 proteins)
  6. 2778483Protein Legume lectin [49904] (23 species)
  7. 2778557Species Furze (Ulex europaeus), UEA-I [TaxId:3902] [49917] (2 PDB entries)
  8. 2778559Domain d1fx5b_: 1fx5 B: [24136]
    complexed with ca, mn, mrd

Details for d1fx5b_

PDB Entry: 1fx5 (more details), 2.2 Å

PDB Description: crystal structure analysis of ulex europaeus lectin i
PDB Compounds: (B:) anti-H(O) lectin I

SCOPe Domain Sequences for d1fx5b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fx5b_ b.29.1.1 (B:) Legume lectin {Furze (Ulex europaeus), UEA-I [TaxId: 3902]}
sddlsfkfknfsqngkdlsfqgnasvietgvlqlnkvgnnlpdetggiaryiapihiwnc
ntgelasfitsfsffmetsanpkaatdgltfflappdsplrraggyfglfndtkcdssyq
tvavefdtigspvnfwdpgfphigidvncvksinaerwnkryglnnvanveiiyeasskt
ltasltypsdqtsisvtsivdlkeilpewvsvgfsgstyigrqathevlnwyftstfin

SCOPe Domain Coordinates for d1fx5b_:

Click to download the PDB-style file with coordinates for d1fx5b_.
(The format of our PDB-style files is described here.)

Timeline for d1fx5b_: