Lineage for d2bvja_ (2bvj A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2330957Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2330958Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2331668Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2331669Protein automated matches [190847] (73 species)
    not a true protein
  7. 2332232Species Streptomyces venezuelae [TaxId:54571] [255065] (14 PDB entries)
  8. 2332242Domain d2bvja_: 2bvj A: [241359]
    automated match to d4dnja_
    complexed with bme, dtt, hem

Details for d2bvja_

PDB Entry: 2bvj (more details), 2.1 Å

PDB Description: ligand-free structure of cytochrome p450 pikc (cyp107l1)
PDB Compounds: (A:) cytochrome p450 monooxygenase

SCOPe Domain Sequences for d2bvja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bvja_ a.104.1.0 (A:) automated matches {Streptomyces venezuelae [TaxId: 54571]}
vldlgalgqdfaadpyptyarlraegpahrvrtpegdevwlvvgydraravladprfskd
wrnsttplteaeaalnhnmlesdpprhtrlrklvareftmrrvellrprvqeivdglvda
mlaapdgradlmeslawplpitvisellgvpepdraafrvwtdafvfpddpaqaqtamae
msgylsrlidskrgqdgedllsalvrtsdedgsrltseellgmahillvaghettvnlia
ngmyallshpdqlaalradmtlldgaveemlryegpvesatyrfpvepvdldgtvipagd
tvlvvladahrtperfpdphrfdirrdtaghlafghgihfcigaplarleariavralle
rcpdlaldvspgelvwypnpmirglkalpirwrrg

SCOPe Domain Coordinates for d2bvja_:

Click to download the PDB-style file with coordinates for d2bvja_.
(The format of our PDB-style files is described here.)

Timeline for d2bvja_: