Lineage for d2bvhd2 (2bvh D:5-205)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2223741Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily)
    consists of two alpha+beta subdomains
  4. 2223742Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families) (S)
  5. 2223743Family d.145.1.1: FAD-linked oxidases, N-terminal domain [56177] (8 proteins)
  6. 2223744Protein 6-hydroxy-d-nicotine oxidase [254378] (1 species)
  7. 2223745Species Arthrobacter nicotinovorans [TaxId:29320] [254811] (2 PDB entries)
  8. 2223751Domain d2bvhd2: 2bvh D:5-205 [241358]
    Other proteins in same PDB: d2bvha1, d2bvhb1, d2bvhc1, d2bvhd1
    complexed with fad

Details for d2bvhd2

PDB Entry: 2bvh (more details), 2.9 Å

PDB Description: crystal structure of 6-hydoxy-d-nicotine oxidase from arthrobacter nicotinovorans. crystal form 2 (p21)
PDB Compounds: (D:) 6-hydroxy-d-nicotine oxidase

SCOPe Domain Sequences for d2bvhd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bvhd2 d.145.1.1 (D:5-205) 6-hydroxy-d-nicotine oxidase {Arthrobacter nicotinovorans [TaxId: 29320]}
klatplsiqgeviypddsgfdaianiwdgrhlqrpsliarclsagdvaksvryacdngle
isvrsgghnpngyatndggivldlrlmnsihidtagsrarigggvisgdlvkeaakfgla
avtgmhpkvgfcglalnggvgfltpkyglasdnilgatlvtatgdviycsdderpelfwa
vrgagpnfgvvtevevqlyel

SCOPe Domain Coordinates for d2bvhd2:

Click to download the PDB-style file with coordinates for d2bvhd2.
(The format of our PDB-style files is described here.)

Timeline for d2bvhd2: