| Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
| Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily) consists of two alpha+beta subdomains |
Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families) ![]() |
| Family d.145.1.1: FAD-linked oxidases, N-terminal domain [56177] (7 proteins) |
| Protein 6-hydroxy-d-nicotine oxidase [254378] (1 species) |
| Species Arthrobacter nicotinovorans [TaxId:29320] [254811] (2 PDB entries) |
| Domain d2bvhd2: 2bvh D:5-205 [241358] Other proteins in same PDB: d2bvha1, d2bvhb1, d2bvhc1, d2bvhd1 complexed with fad |
PDB Entry: 2bvh (more details), 2.9 Å
SCOPe Domain Sequences for d2bvhd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bvhd2 d.145.1.1 (D:5-205) 6-hydroxy-d-nicotine oxidase {Arthrobacter nicotinovorans [TaxId: 29320]}
klatplsiqgeviypddsgfdaianiwdgrhlqrpsliarclsagdvaksvryacdngle
isvrsgghnpngyatndggivldlrlmnsihidtagsrarigggvisgdlvkeaakfgla
avtgmhpkvgfcglalnggvgfltpkyglasdnilgatlvtatgdviycsdderpelfwa
vrgagpnfgvvtevevqlyel
Timeline for d2bvhd2: