![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.32: FAD-linked oxidases, C-terminal domain [55103] (7 families) ![]() duplication: contains two subdomains of this fold |
![]() | Family d.58.32.5: 6-hydroxy-d-nicotine oxidase [254168] (2 proteins) Pfam PF08031; PubMed 16095622 |
![]() | Protein 6-hydroxy-d-nicotine oxidase [254377] (1 species) |
![]() | Species Arthrobacter nicotinovorans [TaxId:29320] [254810] (2 PDB entries) |
![]() | Domain d2bvhc1: 2bvh C:206-457 [241355] Other proteins in same PDB: d2bvha2, d2bvhb2, d2bvhc2, d2bvhd2 complexed with fad |
PDB Entry: 2bvh (more details), 2.9 Å
SCOPe Domain Sequences for d2bvhc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bvhc1 d.58.32.5 (C:206-457) 6-hydroxy-d-nicotine oxidase {Arthrobacter nicotinovorans [TaxId: 29320]} prkmlagfitwapsvselaglltslldalnemadhiypsvfvgvdenrapsvtvcvghlg gldiaerdiarlrglgrtvsdsiavrsydevvalnaevgsfedgmsnlwidreiampnar faeaiagnldkfvsepasggsvkleiegmpfgnpkrtparhrdamgvlalaewsgaapgs ekypelareldaallragvttsgfgllnnnsevtaemvaevykpevysrlaavkreydpe nrfrhnynidpe
Timeline for d2bvhc1: