SCOPe 2.08: Domain d2bvhb2: 2bvh B:5-205

Lineage for d2bvhb2 (2bvh B:5-205)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily)
   consists of two alpha+beta subdomains

4. Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families)

5. Family d.145.1.1: FAD-linked oxidases, N-terminal domain [56177] (8 proteins)

6. Protein 6-hydroxy-d-nicotine oxidase [254378] (1 species)

7. Species Arthrobacter nicotinovorans [TaxId:29320] [254811] (2 PDB entries)

8. Domain d2bvhb2: 2bvh B:5-205 [241354]
   Other proteins in same PDB: d2bvha1, d2bvhb1, d2bvhc1, d2bvhd1
   complexed with fad

Details for d2bvhb2

PDB Entry: 2bvh, 2.9 Å

PDB Description: crystal structure of 6-hydoxy-d-nicotine oxidase from arthrobacter nicotinovorans. crystal form 2 (p21)

PDB Compounds: (B:) 6-hydroxy-d-nicotine oxidase

SCOPe Domain Sequences for d2bvhb2:

Sequence; same for both SEQRES and ATOM records:

>d2bvhb2 d.145.1.1 (B:5-205) 6-hydroxy-d-nicotine oxidase {Arthrobacter nicotinovorans [TaxId: 29320]}
klatplsiqgeviypddsgfdaianiwdgrhlqrpsliarclsagdvaksvryacdngle
isvrsgghnpngyatndggivldlrlmnsihidtagsrarigggvisgdlvkeaakfgla
avtgmhpkvgfcglalnggvgfltpkyglasdnilgatlvtatgdviycsdderpelfwa
vrgagpnfgvvtevevqlyel

Timeline for d2bvhb2:

• d2bvhb2 first appeared in SCOPe 2.04
  
• d2bvhb2 appears in SCOPe 2.07