Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily) consists of two alpha+beta subdomains |
Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families) |
Family d.145.1.1: FAD-linked oxidases, N-terminal domain [56177] (8 proteins) |
Protein 6-hydroxy-d-nicotine oxidase [254378] (1 species) |
Species Arthrobacter nicotinovorans [TaxId:29320] [254811] (2 PDB entries) |
Domain d2bvha2: 2bvh A:5-205 [241352] Other proteins in same PDB: d2bvha1, d2bvhb1, d2bvhc1, d2bvhd1 complexed with fad |
PDB Entry: 2bvh (more details), 2.9 Å
SCOPe Domain Sequences for d2bvha2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bvha2 d.145.1.1 (A:5-205) 6-hydroxy-d-nicotine oxidase {Arthrobacter nicotinovorans [TaxId: 29320]} klatplsiqgeviypddsgfdaianiwdgrhlqrpsliarclsagdvaksvryacdngle isvrsgghnpngyatndggivldlrlmnsihidtagsrarigggvisgdlvkeaakfgla avtgmhpkvgfcglalnggvgfltpkyglasdnilgatlvtatgdviycsdderpelfwa vrgagpnfgvvtevevqlyel
Timeline for d2bvha2: