Lineage for d2bvgd2 (2bvg D:206-457)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2955209Superfamily d.58.32: FAD-linked oxidases, C-terminal domain [55103] (7 families) (S)
    duplication: contains two subdomains of this fold
  5. 2955293Family d.58.32.5: 6-hydroxy-d-nicotine oxidase [254168] (2 proteins)
    Pfam PF08031; PubMed 16095622
  6. 2955302Protein automated matches [254491] (1 species)
    not a true protein
  7. 2955303Species Arthrobacter nicotinovorans [TaxId:29320] [255064] (1 PDB entry)
  8. 2955307Domain d2bvgd2: 2bvg D:206-457 [241350]
    Other proteins in same PDB: d2bvga1, d2bvgb1, d2bvgc1, d2bvgd1
    automated match to d2bvha1
    complexed with fad

Details for d2bvgd2

PDB Entry: 2bvg (more details), 3.18 Å

PDB Description: crystal structure of 6-hydoxy-d-nicotine oxidase from arthrobacter nicotinovorans. crystal form 1 (p21)
PDB Compounds: (D:) 6-hydroxy-d-nicotine oxidase

SCOPe Domain Sequences for d2bvgd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bvgd2 d.58.32.5 (D:206-457) automated matches {Arthrobacter nicotinovorans [TaxId: 29320]}
prkmlagfitwapsvselaglltslldalnemadhiypsvfvgvdenrapsvtvcvghlg
gldiaerdiarlrglgrtvsdsiavrsydevvalnaevgsfedgmsnlwidreiampnar
faeaiagnldkfvsepasggsvkleiegmpfgnpkrtparhrdamgvlalaewsgaapgs
ekypelareldaallragvttsgfgllnnnsevtaemvaevykpevysrlaavkreydpe
nrfrhnynidpe

SCOPe Domain Coordinates for d2bvgd2:

Click to download the PDB-style file with coordinates for d2bvgd2.
(The format of our PDB-style files is described here.)

Timeline for d2bvgd2: