SCOPe 2.08: Domain d2bvgd2: 2bvg D:206-457

Lineage for d2bvgd2 (2bvg D:206-457)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.32: FAD-linked oxidases, C-terminal domain [55103] (7 families)
   duplication: contains two subdomains of this fold

5. Family d.58.32.5: 6-hydroxy-d-nicotine oxidase [254168] (2 proteins)
   Pfam PF08031; PubMed 16095622

6. Protein automated matches [254491] (1 species)
   not a true protein

7. Species Arthrobacter nicotinovorans [TaxId:29320] [255064] (1 PDB entry)

8. Domain d2bvgd2: 2bvg D:206-457 [241350]
   Other proteins in same PDB: d2bvga1, d2bvgb1, d2bvgc1, d2bvgd1
   automated match to d2bvha1
   complexed with fad

Details for d2bvgd2

PDB Entry: 2bvg, 3.18 Å

PDB Description: crystal structure of 6-hydoxy-d-nicotine oxidase from arthrobacter nicotinovorans. crystal form 1 (p21)

PDB Compounds: (D:) 6-hydroxy-d-nicotine oxidase

SCOPe Domain Sequences for d2bvgd2:

Sequence; same for both SEQRES and ATOM records:

>d2bvgd2 d.58.32.5 (D:206-457) automated matches {Arthrobacter nicotinovorans [TaxId: 29320]}
prkmlagfitwapsvselaglltslldalnemadhiypsvfvgvdenrapsvtvcvghlg
gldiaerdiarlrglgrtvsdsiavrsydevvalnaevgsfedgmsnlwidreiampnar
faeaiagnldkfvsepasggsvkleiegmpfgnpkrtparhrdamgvlalaewsgaapgs
ekypelareldaallragvttsgfgllnnnsevtaemvaevykpevysrlaavkreydpe
nrfrhnynidpe

Timeline for d2bvgd2:

• d2bvgd2 first appeared in SCOPe 2.04
  
• d2bvgd2 appears in SCOPe 2.07