Lineage for d1fx5a_ (1fx5 A:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 12390Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
  4. 12391Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (11 families) (S)
  5. 12392Family b.29.1.1: Legume lectins [49900] (4 proteins)
  6. 12495Protein Lectin [49904] (15 species)
  7. 12518Species Furze (Ulex europaeus), UEA-I [TaxId:3902] [49917] (1 PDB entry)
  8. 12519Domain d1fx5a_: 1fx5 A: [24135]

Details for d1fx5a_

PDB Entry: 1fx5 (more details), 2.2 Å

PDB Description: crystal structure analysis of ulex europaeus lectin i

SCOP Domain Sequences for d1fx5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fx5a_ b.29.1.1 (A:) Lectin {Furze (Ulex europaeus), UEA-I}
sddlsfkfknfsqngkdlsfqgnasvietgvlqlnkvgnnlpdetggiaryiapihiwnc
ntgelasfitsfsffmetsanpkaatdgltfflappdsplrraggyfglfndtkcdssyq
tvavefdtigspvnfwdpgfphigidvncvksinaerwnkryglnnvanveiiyeasskt
ltasltypsdqtsisvtsivdlkeilpewvsvgfsgstyigrqathevlnwyftstfint

SCOP Domain Coordinates for d1fx5a_:

Click to download the PDB-style file with coordinates for d1fx5a_.
(The format of our PDB-style files is described here.)

Timeline for d1fx5a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1fx5b_