SCOPe 2.08: Domain d1fx5a_: 1fx5 A:

Lineage for d1fx5a_ (1fx5 A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families)

5. Family b.29.1.1: Legume lectins [49900] (5 proteins)

6. Protein Legume lectin [49904] (23 species)

7. Species Furze (Ulex europaeus), UEA-I [TaxId:3902] [49917] (2 PDB entries)

8. Domain d1fx5a_: 1fx5 A: [24135]
   complexed with ca, mn, mrd

Details for d1fx5a_

PDB Entry: 1fx5, 2.2 Å

PDB Description: crystal structure analysis of ulex europaeus lectin i

PDB Compounds: (A:) anti-H(O) lectin I

SCOPe Domain Sequences for d1fx5a_:

Sequence; same for both SEQRES and ATOM records:

>d1fx5a_ b.29.1.1 (A:) Legume lectin {Furze (Ulex europaeus), UEA-I [TaxId: 3902]}
sddlsfkfknfsqngkdlsfqgnasvietgvlqlnkvgnnlpdetggiaryiapihiwnc
ntgelasfitsfsffmetsanpkaatdgltfflappdsplrraggyfglfndtkcdssyq
tvavefdtigspvnfwdpgfphigidvncvksinaerwnkryglnnvanveiiyeasskt
ltasltypsdqtsisvtsivdlkeilpewvsvgfsgstyigrqathevlnwyftstfint

Timeline for d1fx5a_:

• d1fx5a_ first appeared (with stable ids) in SCOP 1.55
  
• d1fx5a_ appears in SCOPe 2.07