Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.32: FAD-linked oxidases, C-terminal domain [55103] (7 families) duplication: contains two subdomains of this fold |
Family d.58.32.5: 6-hydroxy-d-nicotine oxidase [254168] (2 proteins) Pfam PF08031; PubMed 16095622 |
Protein automated matches [254491] (1 species) not a true protein |
Species Arthrobacter nicotinovorans [TaxId:29320] [255064] (1 PDB entry) |
Domain d2bvga2: 2bvg A:206-457 [241344] Other proteins in same PDB: d2bvga1, d2bvgb1, d2bvgc1, d2bvgd1 automated match to d2bvha1 complexed with fad |
PDB Entry: 2bvg (more details), 3.18 Å
SCOPe Domain Sequences for d2bvga2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bvga2 d.58.32.5 (A:206-457) automated matches {Arthrobacter nicotinovorans [TaxId: 29320]} prkmlagfitwapsvselaglltslldalnemadhiypsvfvgvdenrapsvtvcvghlg gldiaerdiarlrglgrtvsdsiavrsydevvalnaevgsfedgmsnlwidreiampnar faeaiagnldkfvsepasggsvkleiegmpfgnpkrtparhrdamgvlalaewsgaapgs ekypelareldaallragvttsgfgllnnnsevtaemvaevykpevysrlaavkreydpe nrfrhnynidpe
Timeline for d2bvga2: