Lineage for d2bvga1 (2bvg A:5-205)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1675721Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily)
    consists of two alpha+beta subdomains
  4. 1675722Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families) (S)
  5. 1675723Family d.145.1.1: FAD-linked oxidases, N-terminal domain [56177] (7 proteins)
  6. 1675786Protein automated matches [254445] (2 species)
    not a true protein
  7. 1675787Species Arthrobacter nicotinovorans [TaxId:29320] [255063] (1 PDB entry)
  8. 1675788Domain d2bvga1: 2bvg A:5-205 [241343]
    Other proteins in same PDB: d2bvga2, d2bvgb2, d2bvgc2, d2bvgd2
    automated match to d2bvha2
    complexed with fad

Details for d2bvga1

PDB Entry: 2bvg (more details), 3.18 Å

PDB Description: crystal structure of 6-hydoxy-d-nicotine oxidase from arthrobacter nicotinovorans. crystal form 1 (p21)
PDB Compounds: (A:) 6-hydroxy-d-nicotine oxidase

SCOPe Domain Sequences for d2bvga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bvga1 d.145.1.1 (A:5-205) automated matches {Arthrobacter nicotinovorans [TaxId: 29320]}
klatplsiqgeviypddsgfdaianiwdgrhlqrpsliarclsagdvaksvryacdngle
isvrsgghnpngyatndggivldlrlmnsihidtagsrarigggvisgdlvkeaakfgla
avtgmhpkvgfcglalnggvgfltpkyglasdnilgatlvtatgdviycsdderpelfwa
vrgagpnfgvvtevevqlyel

SCOPe Domain Coordinates for d2bvga1:

Click to download the PDB-style file with coordinates for d2bvga1.
(The format of our PDB-style files is described here.)

Timeline for d2bvga1: