SCOPe 2.08: Domain d2bvga1: 2bvg A:5-205

Lineage for d2bvga1 (2bvg A:5-205)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily)
   consists of two alpha+beta subdomains

4. Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families)

5. Family d.145.1.1: FAD-linked oxidases, N-terminal domain [56177] (8 proteins)

6. Protein automated matches [254445] (3 species)
   not a true protein

7. Species Arthrobacter nicotinovorans [TaxId:29320] [255063] (1 PDB entry)

8. Domain d2bvga1: 2bvg A:5-205 [241343]
   Other proteins in same PDB: d2bvga2, d2bvgb2, d2bvgc2, d2bvgd2
   automated match to d2bvha2
   complexed with fad

Details for d2bvga1

PDB Entry: 2bvg, 3.18 Å

PDB Description: crystal structure of 6-hydoxy-d-nicotine oxidase from arthrobacter nicotinovorans. crystal form 1 (p21)

PDB Compounds: (A:) 6-hydroxy-d-nicotine oxidase

SCOPe Domain Sequences for d2bvga1:

Sequence; same for both SEQRES and ATOM records:

>d2bvga1 d.145.1.1 (A:5-205) automated matches {Arthrobacter nicotinovorans [TaxId: 29320]}
klatplsiqgeviypddsgfdaianiwdgrhlqrpsliarclsagdvaksvryacdngle
isvrsgghnpngyatndggivldlrlmnsihidtagsrarigggvisgdlvkeaakfgla
avtgmhpkvgfcglalnggvgfltpkyglasdnilgatlvtatgdviycsdderpelfwa
vrgagpnfgvvtevevqlyel

Timeline for d2bvga1:

• d2bvga1 first appeared in SCOPe 2.04
  
• d2bvga1 appears in SCOPe 2.07