![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily) consists of two alpha+beta subdomains |
![]() | Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families) ![]() |
![]() | Family d.145.1.1: FAD-linked oxidases, N-terminal domain [56177] (8 proteins) |
![]() | Protein automated matches [254445] (3 species) not a true protein |
![]() | Species Arthrobacter nicotinovorans [TaxId:29320] [255063] (1 PDB entry) |
![]() | Domain d2bvga1: 2bvg A:5-205 [241343] Other proteins in same PDB: d2bvga2, d2bvgb2, d2bvgc2, d2bvgd2 automated match to d2bvha2 complexed with fad |
PDB Entry: 2bvg (more details), 3.18 Å
SCOPe Domain Sequences for d2bvga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bvga1 d.145.1.1 (A:5-205) automated matches {Arthrobacter nicotinovorans [TaxId: 29320]} klatplsiqgeviypddsgfdaianiwdgrhlqrpsliarclsagdvaksvryacdngle isvrsgghnpngyatndggivldlrlmnsihidtagsrarigggvisgdlvkeaakfgla avtgmhpkvgfcglalnggvgfltpkyglasdnilgatlvtatgdviycsdderpelfwa vrgagpnfgvvtevevqlyel
Timeline for d2bvga1: