Lineage for d2bvfb1 (2bvf B:5-205)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1675721Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily)
    consists of two alpha+beta subdomains
  4. 1675722Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families) (S)
  5. 1675723Family d.145.1.1: FAD-linked oxidases, N-terminal domain [56177] (7 proteins)
  6. 1675724Protein 6-hydroxy-d-nicotine oxidase [254378] (1 species)
  7. 1675725Species Arthrobacter nicotinovorans [TaxId:29320] [254811] (2 PDB entries)
  8. 1675727Domain d2bvfb1: 2bvf B:5-205 [241341]
    Other proteins in same PDB: d2bvfa2, d2bvfb2
    automated match to d2bvha2
    complexed with fad

Details for d2bvfb1

PDB Entry: 2bvf (more details), 1.92 Å

PDB Description: crystal structure of 6-hydoxy-d-nicotine oxidase from arthrobacter nicotinovorans. crystal form 3 (p1)
PDB Compounds: (B:) 6-hydroxy-d-nicotine oxidase

SCOPe Domain Sequences for d2bvfb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bvfb1 d.145.1.1 (B:5-205) 6-hydroxy-d-nicotine oxidase {Arthrobacter nicotinovorans [TaxId: 29320]}
klatplsiqgeviypddsgfdaianiwdgrhlqrpsliarclsagdvaksvryacdngle
isvrsgghnpngyatndggivldlrlmnsihidtagsrarigggvisgdlvkeaakfgla
avtgmhpkvgfcglalnggvgfltpkyglasdnilgatlvtatgdviycsdderpelfwa
vrgagpnfgvvtevevqlyel

SCOPe Domain Coordinates for d2bvfb1:

Click to download the PDB-style file with coordinates for d2bvfb1.
(The format of our PDB-style files is described here.)

Timeline for d2bvfb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2bvfb2